Share this post on:

Name :
AGER (Human) Recombinant Protein

Biological Activity :
Purified AGER (AAH20669.1 23 a.a. – 342 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro

Tag :

Protein Accession No. :
AAH20669.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=177

Amino Acid Sequence :
AQNITARIGEPLVLKCKGAPKKPPQRLEWNLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA

Molecular Weight :
40.48

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Human

Interspecies Antigen Sequence :
Mouse (79); Rat (79)

Preparation Method :
Transfection of pSuper-AGER plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.

Purification :
Strep-Tactin affinity columns

Quality Control Testing :

Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Applications :
Western Blot, Enzyme-linked Immunoabsorbent Assay, SDS-PAGE, Protein Interaction,

Gene Name :
AGER

Gene Alias :
MGC22357, RAGE

Gene Description :
advanced glycosylation end product-specific receptor

Gene Summary :
This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq

Other Designations :
OTTHUMP00000029155|OTTHUMP00000029156|advanced glycosylation end product-specific receptor RAGE3|advanced glycosylation end product-specific receptor variant sRAGE1|advanced glycosylation end product-specific receptor variant sRAGE2|receptor for advanced

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-33 ProteinAccession
IL-1 alpha ProteinBiological Activity
Popular categories:
Prolactin
SMAD7

Share this post on:

Author: Betaine hydrochloride